DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and RBP47C

DIOPT Version :10

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_175180.1 Gene:RBP47C / 841157 AraportID:AT1G47490 Length:432 Species:Arabidopsis thaliana


Alignment Length:209 Identity:54/209 - (25%)
Similarity:88/209 - (42%) Gaps:43/209 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EAFS-PYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVLVAANR 108
            |.|| .|..::...||.|.:|..:||..:|:|...::..||..||||  :....|.:::..|..|
plant   215 ETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAMTEMNG--VKCSSRAMRIGPATPR 277

  Fly   109 NQGSNKSENEQEKYV---------------RLFI-VIPKTATEEDIREEFSQWGDVESVTIVKEK 157
               ......:|..|:               .:|: .:..:.|:||:::.|:::|::.||.|    
plant   278 ---KTNGYQQQGGYMPNGTLTRPEGDIMNTTIFVGGLDSSVTDEDLKQPFNEFGEIVSVKI---- 335

  Fly   158 NNGNP--KGFGYVRFTKFYYAAVAFENCS----AKYKAVFAEPKGSTRTQ-RDQYGRPSEDNPLY 215
                |  ||.|:|:|.....|..|.|..:    .|.....:..:.....| ||:||....| |.|
plant   336 ----PVGKGCGFVQFVNRPNAEEALEKLNGTVIGKQTVRLSWGRNPANKQPRDKYGNQWVD-PYY 395

  Fly   216 SSSGRGNSNFNGGG 229
                 |...:||.|
plant   396 -----GGQFYNGYG 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:409801 19/60 (32%)
RRM_SF 122..195 CDD:473069 20/94 (21%)
RRM3_RBM45 267..339 CDD:409803
RRM4_RBM45 383..449 CDD:409804
RBP47CNP_175180.1 RRM1_SECp43_like 102..184 CDD:409780
RRM2_SECp43_like 196..275 CDD:409781 19/61 (31%)
RRM3_NGR1_NAM8_like 303..374 CDD:409782 19/78 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.