DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and AT1G33470

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_174613.2 Gene:AT1G33470 / 840240 AraportID:AT1G33470 Length:245 Species:Arabidopsis thaliana


Alignment Length:141 Identity:31/141 - (21%)
Similarity:54/141 - (38%) Gaps:48/141 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 IREEFSQWGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVAF-----------ENCSAKYKAVF 191
            :|..|.|:||:....::.:|::|..||:|:|.|.....|..|.           .||:.   |.|
plant    23 LRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRANCNL---AAF 84

  Fly   192 AEPKGSTRTQRDQYGRPSEDNPLYSS-SGRG-------NSNFNGGGSS--------------SGG 234
            ..          |..:||  :|::.. .|||       .::|....::              :..
plant    85 GV----------QRSKPS--SPIHGHVGGRGMKVTSPFKTHFGTAATAIPSPLPFSHYTLPYTNP 137

  Fly   235 GGSNSYNNDWN 245
            .|.:||:.|:|
plant   138 FGFSSYSMDYN 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812
RRM2_RBM45 122..195 CDD:240813 18/67 (27%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
AT1G33470NP_174613.2 RRM_RBM24_RBM38_like 7..82 CDD:240830 16/61 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.