DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and ATRBP45C

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_567764.1 Gene:ATRBP45C / 828808 AraportID:AT4G27000 Length:415 Species:Arabidopsis thaliana


Alignment Length:233 Identity:54/233 - (23%)
Similarity:92/233 - (39%) Gaps:48/233 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TEEDFREAF-SPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKV 102
            |:....|.| :.|..::...||.|:.|..:||..:|:|:..|:..:|..||||:...  .|.::.
plant   185 TDHMLTETFKAVYSSVKGAKVVNDRTTGRSKGYGFVRFADESEQIRAMTEMNGQYCS--SRPMRT 247

  Fly   103 LVAANR-----------NQGSNKSENEQEKYVRLFIVIPKTATEEDIREEFSQWGDVESVTIVKE 156
            ..|||:           |...|..|::..........:.::.||:|::..|.|:|::..|.|...
plant   248 GPAANKKPLTMQPASYQNTQGNSGESDPTNTTIFVGAVDQSVTEDDLKSVFGQFGELVHVKIPAG 312

  Fly   157 KNNGNPKGFGYVRFTKFYYAAVAFENCSA---------KYKAVFAEPKGSTRTQRDQ-------- 204
            |..|         |.::...|.|.:..|.         ..:..:.....:.:||.||        
plant   313 KRCG---------FVQYANRACAEQALSVLNGTQLGGQSIRLSWGRSPSNKQTQPDQAQYGGGGG 368

  Fly   205 -YGRPSEDNPLYSSSGRG----NSNFNGGGSSSGGGGS 237
             ||.|.:.   |.:.|..    :.|...||.:.||.|:
plant   369 YYGYPPQG---YEAYGYAPPPQDPNAYYGGYAGGGYGN 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 19/66 (29%)
RRM2_RBM45 122..195 CDD:240813 14/81 (17%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
ATRBP45CNP_567764.1 RRM1_SECp43_like 81..158 CDD:240790
ELAV_HUD_SF 91..346 CDD:273741 39/171 (23%)
RRM2_SECp43_like 172..251 CDD:240791 19/67 (28%)
RRM3_NGR1_NAM8_like 277..348 CDD:240792 14/79 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.