DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and AT4G26650

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_567753.1 Gene:AT4G26650 / 828772 AraportID:AT4G26650 Length:455 Species:Arabidopsis thaliana


Alignment Length:294 Identity:64/294 - (21%)
Similarity:117/294 - (39%) Gaps:65/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYRSQSRSGGGR---GGQEYSNDDDPPMSRLFIICNKAHTEEDFREAFSPYGEIEDIWVVKDKHT 64
            :.:.:|.|..|:   ||..:..|                 ||..:|.|..||::.:..:::|:.|
plant     5 EQKMESASDLGKLFIGGISWDTD-----------------EERLQEYFGKYGDLVEAVIMRDRTT 52

  Fly    65 QENKGIAYVKFSKTSDAAKA---QEEMNGKTIGK-----------MDRTLKVLVAANRNQGSNKS 115
            ...:|..::.|:..|.|.:.   :..::|:|:..           :.|....:...:.:.|.|..
plant    53 GRARGFGFIVFADPSVAERVIMDKHIIDGRTVEAKKAVPRDDQQVLKRHASPMHLISPSHGGNGG 117

  Fly   116 ENEQEKYVRLFI-VIPKTATEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAV- 178
            ....:|   :|: .:|.:.||.:.:..|.|:|.:..|.::.:.|...|:|||::.|.......: 
plant   118 GARTKK---IFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMV 179

  Fly   179 ---AFENCSAKYKAV-FAEPK--GSTRTQR-------DQYG---RPSEDNPLYSS--SGRGNSNF 225
               .|...:.|...| .|.||  .||...|       :.||   ..|..|..::|  .|..|:|.
plant   180 LHKTFHELNGKMVEVKRAVPKELSSTTPNRSPLIGYGNNYGVVPNRSSANSYFNSFPPGYNNNNL 244

  Fly   226 NGGGSSSG-GGGSNSY-------NNDWNVSQNND 251
            ...|..|. |.|.|::       |.:.|::.|.|
plant   245 GSAGRFSPIGSGRNAFSSFGLGLNQELNLNSNFD 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 15/93 (16%)
RRM2_RBM45 122..195 CDD:240813 18/78 (23%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
AT4G26650NP_567753.1 RRM1_hnRNPA_hnRNPD_like 17..87 CDD:240771 17/86 (20%)
RRM2_DAZAP1 120..199 CDD:240773 19/81 (23%)
RRM <121..280 CDD:223796 41/161 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.