DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and RBP47B

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_188544.1 Gene:RBP47B / 821447 AraportID:AT3G19130 Length:435 Species:Arabidopsis thaliana


Alignment Length:261 Identity:68/261 - (26%)
Similarity:113/261 - (43%) Gaps:55/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GQEYSNDDDPPMSRLFIICNKAHTEEDFREAFSP-YGEIEDIWVVKDKHTQENKGIAYVKFSKTS 79
            |::.:.::.|.:|......:...|:....|.||. |..::...||.|.:|..:||..:|:|...:
plant   191 GEKRAVENGPDLSVFVGDLSPDVTDVLLHETFSDRYPSVKSAKVVIDSNTGRSKGYGFVRFGDEN 255

  Fly    80 DAAKAQEEMNGKTIGKMDRTLKVLVA------ANRNQ------------GSN-------KSENEQ 119
            :.::|..||||....  :|.::|.:|      ||:.|            |||       :|:.|.
plant   256 ERSRALTEMNGAYCS--NRQMRVGIATPKRAIANQQQHSSQAVILAGGHGSNGSMGYGSQSDGES 318

  Fly   120 EKYVRLFIVIPKTATEEDIREEFSQWGDVESVTIVKEKNNGNP--KGFGYVRFTKFYYAAVAFEN 182
            .........|.....:||:|:.|||:|:|.||.|        |  ||.|:|:|.....|..|.|:
plant   319 TNATIFVGGIDPDVIDEDLRQPFSQFGEVVSVKI--------PVGKGCGFVQFADRKSAEDAIES 375

  Fly   183 CSAKYKAVFAEPKGSTRTQRDQYGRPSEDNPLYSSSGRGNSNFNGG-----GSSSGGGGSNSYNN 242
            .:.   .|..:     .|.|..:||    :|.....|.....:|||     |.::|||.:|.:::
plant   376 LNG---TVIGK-----NTVRLSWGR----SPNKQWRGDSGQQWNGGYSRGHGYNNGGGYANHHDS 428

  Fly   243 D 243
            :
plant   429 N 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 22/80 (28%)
RRM2_RBM45 122..195 CDD:240813 22/74 (30%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
RBP47BNP_188544.1 RRM1_SECp43_like 109..189 CDD:409780
RRM2_SECp43_like 201..280 CDD:409781 21/80 (26%)
RRM_SF 320..391 CDD:418427 24/86 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.