DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and AT3G15010

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_188119.1 Gene:AT3G15010 / 820730 AraportID:AT3G15010 Length:404 Species:Arabidopsis thaliana


Alignment Length:275 Identity:69/275 - (25%)
Similarity:105/275 - (38%) Gaps:68/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DDDPPMSRLFIICNKAH-TEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQ 85
            |.|....:|||....|. |.|..|..||.||::|:..|:.||.|.::||..:|.|.....|..|.
plant    69 DSDISQRKLFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVDGALLAL 133

  Fly    86 EEMNGKTIGKMDRTLKVLVAANRNQGSNKSENEQEKYVRLFIV-IPKTATEEDIREEFSQWGDVE 149
            :|.:.|..|::..|   .:||:.|||:. |:.......::::. :|.....:.:...|..:||||
plant   134 KEPSKKIDGRVTVT---QLAASGNQGTG-SQIADISMRKIYVANVPFDMPADRLLNHFMAYGDVE 194

  Fly   150 SVTIVKEKNNGNPKGFGYVRFTKFYY-------AAVA---------FENCSAKYKAVFAEPKGST 198
            ...:..:|..|..:||..     |.|       ||:|         ..||..   ||..:..|..
plant   195 EGPLGFDKVTGKSRGFAL-----FVYKTAEGAQAALADPVKVIDGKHLNCKL---AVDGKKGGKP 251

  Fly   199 RTQRDQYG---------------RPS----------------------EDNPLYSSSGRGNSNFN 226
            ...:.|.|               ||:                      ..|..:||.|.|::.:.
plant   252 GMPQAQDGGSGHGHVHGEGMGMVRPAGPYGAAGGISAYGGYSGGPPAHHMNSTHSSMGVGSAGYG 316

  Fly   227 GG-GSSSGGGGSNSY 240
            |. |...|.||:..|
plant   317 GHYGGYGGPGGTGVY 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 26/80 (33%)
RRM2_RBM45 122..195 CDD:240813 19/89 (21%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
AT3G15010NP_188119.1 RRM_SF 75..150 CDD:418427 26/77 (34%)
RRM2_NsCP33_like 168..242 CDD:410187 17/81 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.