DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and SCL30A

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_187966.1 Gene:SCL30A / 820559 AraportID:AT3G13570 Length:262 Species:Arabidopsis thaliana


Alignment Length:138 Identity:39/138 - (28%)
Similarity:70/138 - (50%) Gaps:21/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YRSQSRSGGGRGGQEYSNDDDPPMSRLFIICNKAH--TEEDFREAFSPYGEIEDIWVVKDKHTQE 66
            |..:.||...||....|.|.|.|.|  .::.|..|  .:||.|..|..:|.::||::.:|.:|.:
plant    14 YGRRGRSPSPRGRFGGSRDSDLPTS--LLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTGD 76

  Fly    67 NKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVLVA----------ANRNQG--SNKSENEQ 119
            .:|..:::|...:|||:|:.:|:|..:  :.|.|.|:.|          ..|::|  ||:.::.:
plant    77 PRGFGFIQFMDPADAAEAKHQMDGYLL--LGRELTVVFAEENRKKPTEMRTRDRGGRSNRFQDRR 139

  Fly   120 E---KYVR 124
            .   :|.|
plant   140 RSPPRYSR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 24/81 (30%)
RRM2_RBM45 122..195 CDD:240813 2/3 (67%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
SCL30ANP_187966.1 RRM <36..225 CDD:223796 31/116 (27%)
RRM_SF 37..120 CDD:388407 24/86 (28%)
DUF2457 <196..>262 CDD:371058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.