DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and Dazap1

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001365924.1 Gene:Dazap1 / 70248 MGIID:1917498 Length:407 Species:Mus musculus


Alignment Length:207 Identity:49/207 - (23%)
Similarity:87/207 - (42%) Gaps:35/207 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDA----AKAQEEMNGKTIG----- 94
            |:|..|..||.|||:.|..::|||.|.:::|..:|||...:..    |.....::|:.|.     
Mouse    22 TQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCT 86

  Fly    95 ----KMDRTLKVLVAANRNQGSNKS-ENEQEKYVRLFI-VIPKTATEEDIREEFSQWGDVESVTI 153
                :.:||       ...:|..|. .::..|..::|: .||....|.::||.|.::|.|..|.:
Mouse    87 PRGMQPERT-------RPKEGWQKGPRSDSSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVM 144

  Fly   154 VKEKNNGNPKGFGYVRF---------TKFYYAAVAFENCSAKYKAVFAEPKGSTRTQRDQYGRPS 209
            :.:.....|:|||::.|         ...::..:..:....|.    |||:.|......|.|...
Mouse   145 IYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKR----AEPRDSKNQAPGQPGASQ 205

  Fly   210 EDNPLYSSSGRG 221
            ..:.:..|:..|
Mouse   206 WGSRVAPSAANG 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 22/78 (28%)
RRM2_RBM45 122..195 CDD:240813 18/82 (22%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
Dazap1NP_001365924.1 RRM1_DAZAP1 11..92 CDD:409988 20/69 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..117 7/49 (14%)
RRM2_DAZAP1 111..190 CDD:409765 18/82 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.