DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and CG34354

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster


Alignment Length:266 Identity:67/266 - (25%)
Similarity:114/266 - (42%) Gaps:55/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDYRSQSRSGGGRGGQEYSNDDDPPMSRLFIICNKAHTE-EDFREAFSPYGEIEDIWVVKDKHT 64
            ||..:.|.:.      |...|:..|....:|:....|..| :..::||:|:|||.|..||:|..|
  Fly    75 MSQQQQQQQQ------QLVGNNSKPEQFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQT 133

  Fly    65 QENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVLVAANRNQGSNKSENEQ-----EKYVR 124
            .::||..:|.|.|.|:|..|...|||:.:|  .|:::...|..:...:....|.:     |.|.:
  Fly   134 LKSKGYGFVSFVKKSEAETAITAMNGQWLG--SRSIRTNWATRKPPATKADMNAKPLTFDEVYNQ 196

  Fly   125 LFIVIPKTAT---------------EEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRF-TK- 172
               ..|...|               ||.:::.||.:|.::.:.:.|:      ||:.:||| || 
  Fly   197 ---SSPTNCTVYCGGINGALSGFLNEEILQKTFSPYGTIQEIRVFKD------KGYAFVRFSTKE 252

  Fly   173 -FYYAAVAFENCSAKYKAVFAEPKGSTRTQRDQYGRPSEDNPLYSSSGRGNSNFNG--GGSSSGG 234
             ..:|.||..|.....:.|           :..:|:.|.| |.:.|:..|.:...|  .||::..
  Fly   253 AATHAIVAVNNTEINQQPV-----------KCAWGKESGD-PNHMSAIAGGALAQGFPFGSAAAA 305

  Fly   235 GGSNSY 240
            ..:.:|
  Fly   306 AAAAAY 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 28/80 (35%)
RRM2_RBM45 122..195 CDD:240813 21/90 (23%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 27/75 (36%)
RRM3_TIA1_like 202..278 CDD:240800 20/92 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.