DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and PSPC1

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001035879.1 Gene:PSPC1 / 55269 HGNCID:20320 Length:523 Species:Homo sapiens


Alignment Length:200 Identity:50/200 - (25%)
Similarity:84/200 - (42%) Gaps:43/200 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVL 103
            |||||:..|..|||..::::.:|      :|..:::....:.|..|:.|::| ||.| .|.|::.
Human    94 TEEDFKRLFERYGEPSEVFINRD------RGFGFIRLESRTLAEIAKAELDG-TILK-SRPLRIR 150

  Fly   104 VAANRNQGSNKSENEQEKYVRLFIVIPKTATEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYV 168
            .|.:....:.|:             :....:.|.:.:.|||:|.||...:|.: :.|...|.|:|
Human   151 FATHGAALTVKN-------------LSPVVSNELLEQAFSQFGPVEKAVVVVD-DRGRATGKGFV 201

  Fly   169 RFTKFYYAAVAFENC-------SAKYKAVFAEP------------KGSTRTQRDQYGRPSEDNPL 214
            .|.....|..|.|.|       :...:.|..||            |...:||  ||.:..|..|.
Human   202 EFAAKPPARKALERCGDGAFLLTTTPRPVIVEPMEQFDDEDGLPEKLMQKTQ--QYHKEREQPPR 264

  Fly   215 YSSSG 219
            ::..|
Human   265 FAQPG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 20/65 (31%)
RRM2_RBM45 122..195 CDD:240813 20/91 (22%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
PSPC1NP_001035879.1 RRM1_PSP1 81..151 CDD:241030 20/64 (31%)
Sufficient for paraspeckles localization 125..358 38/162 (23%)
RRM2_PSP1 157..236 CDD:241033 21/92 (23%)
NOPS_PSPC1 227..320 CDD:240584 10/44 (23%)
Sufficient for perinucleolar caps localization and interaction with NONO. /evidence=ECO:0000269|PubMed:16148043 231..358 9/40 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 460..523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.