Sequence 1: | NP_647887.1 | Gene: | CG1316 / 38526 | FlyBaseID: | FBgn0035526 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035879.1 | Gene: | PSPC1 / 55269 | HGNCID: | 20320 | Length: | 523 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 50/200 - (25%) |
---|---|---|---|
Similarity: | 84/200 - (42%) | Gaps: | 43/200 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 TEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVL 103
Fly 104 VAANRNQGSNKSENEQEKYVRLFIVIPKTATEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYV 168
Fly 169 RFTKFYYAAVAFENC-------SAKYKAVFAEP------------KGSTRTQRDQYGRPSEDNPL 214
Fly 215 YSSSG 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1316 | NP_647887.1 | RRM1_RBM45 | 25..105 | CDD:240812 | 20/65 (31%) |
RRM2_RBM45 | 122..195 | CDD:240813 | 20/91 (22%) | ||
RRM3_RBM45 | 267..339 | CDD:240814 | |||
RRM4_RBM45 | 383..449 | CDD:240815 | |||
PSPC1 | NP_001035879.1 | RRM1_PSP1 | 81..151 | CDD:241030 | 20/64 (31%) |
Sufficient for paraspeckles localization | 125..358 | 38/162 (23%) | |||
RRM2_PSP1 | 157..236 | CDD:241033 | 21/92 (23%) | ||
NOPS_PSPC1 | 227..320 | CDD:240584 | 10/44 (23%) | ||
Sufficient for perinucleolar caps localization and interaction with NONO. /evidence=ECO:0000269|PubMed:16148043 | 231..358 | 9/40 (23%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 460..523 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |