Sequence 1: | NP_647887.1 | Gene: | CG1316 / 38526 | FlyBaseID: | FBgn0035526 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024305408.1 | Gene: | RBM23 / 55147 | HGNCID: | 20155 | Length: | 515 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 47/202 - (23%) |
---|---|---|---|
Similarity: | 95/202 - (47%) | Gaps: | 29/202 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 YRSQSRSGGGRGGQEYS---NDDDP---PMSRL--------FIICNKAHTE---EDFREAFSPYG 51
Fly 52 EIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVLVAAN---RNQGSN 113
Fly 114 KSENEQEKY---VRLFI-VIPKTATEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRFTKFY 174
Fly 175 YAAVAFE 181 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1316 | NP_647887.1 | RRM1_RBM45 | 25..105 | CDD:240812 | 19/93 (20%) |
RRM2_RBM45 | 122..195 | CDD:240813 | 16/64 (25%) | ||
RRM3_RBM45 | 267..339 | CDD:240814 | |||
RRM4_RBM45 | 383..449 | CDD:240815 | |||
RBM23 | XP_024305408.1 | RRM | 143..514 | CDD:330708 | 47/202 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |