DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and mod

DIOPT Version :10

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_524614.2 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster


Alignment Length:223 Identity:50/223 - (22%)
Similarity:92/223 - (41%) Gaps:57/223 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NKAHTEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRT 99
            :::::.:...:.|..:|::|:|.||..|..     :|:|.|.::..|.||..:::|||:.|.:..
  Fly   350 HESYSSDALEKIFKKFGDVEEIDVVCSKAV-----LAFVTFKQSDAATKALAQLDGKTVNKFEWK 409

  Fly   100 LKVLVAANRNQGSNKSENEQEKYVRLFIVIPKTATEEDIREEFSQWGDVESV------TIVKEKN 158
            |            ::.|........|...:...|||.|:|:.|:..|::||:      .:||.|:
  Fly   410 L------------HRFERSTSGRAILVTNLTSDATEADLRKVFNDSGEIESIIMLGQKAVVKFKD 462

  Fly   159 NGNPKGFGYVRFTKFYYAAVAFENCSAKYKAVFAEPK--------------GSTRTQRDQYGRPS 209
            :..        |.|.:.|..:..|.:    .:|.||.              |.||..| ::.:.:
  Fly   463 DEG--------FCKSFLANESIVNNA----PIFIEPNSLLKHRLLKKRLAIGQTRAPR-KFQKDT 514

  Fly   210 EDNPLYSSSGRGNSNFNGGGSSSGGGGS 237
            :.|       .|...||...:...||.|
  Fly   515 KPN-------FGKKPFNKRPAQENGGKS 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:409801 18/69 (26%)
RRM_SF 122..195 CDD:473069 19/78 (24%)
RRM3_RBM45 267..339 CDD:409803
RRM4_RBM45 383..449 CDD:409804
modNP_524614.2 RRM_SF 177..244 CDD:473069
PABP-1234 262..>470 CDD:130689 34/144 (24%)
RRM_SF 339..414 CDD:473069 18/80 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.