Sequence 1: | NP_647887.1 | Gene: | CG1316 / 38526 | FlyBaseID: | FBgn0035526 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262897.1 | Gene: | Rox8 / 42848 | FlyBaseID: | FBgn0005649 | Length: | 470 | Species: | Drosophila melanogaster |
Alignment Length: | 238 | Identity: | 54/238 - (22%) |
---|---|---|---|
Similarity: | 93/238 - (39%) | Gaps: | 79/238 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 EDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVLVA 105
Fly 106 ANR---------------------NQGSNKSENEQEKYVRLFI-------------VIPKTATEE 136
Fly 137 DIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVAFENCSAKYKAVFAEPKGSTRTQ 201
Fly 202 RDQYGRPSEDNPLYSSSGRGN--SNFNGGGSSSGGGGSNSYNN 242 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1316 | NP_647887.1 | RRM1_RBM45 | 25..105 | CDD:240812 | 27/63 (43%) |
RRM2_RBM45 | 122..195 | CDD:240813 | 14/85 (16%) | ||
RRM3_RBM45 | 267..339 | CDD:240814 | |||
RRM4_RBM45 | 383..449 | CDD:240815 | |||
Rox8 | NP_001262897.1 | ELAV_HUD_SF | 5..274 | CDD:273741 | 41/172 (24%) |
RRM1_TIA1_like | 9..80 | CDD:240798 | |||
RRM2_TIA1_like | 96..170 | CDD:240799 | 27/62 (44%) | ||
RRM3_TIA1_like | 221..294 | CDD:240800 | 19/113 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR10352 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |