DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and Rox8

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster


Alignment Length:238 Identity:54/238 - (22%)
Similarity:93/238 - (39%) Gaps:79/238 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVLVA 105
            |..||||:|:|||.:..:|:|.||.::||.|:|.|.|.::|..|.:.|||:.||  .|:::...:
  Fly   109 ETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIG--SRSIRTNWS 171

  Fly   106 ANR---------------------NQGSNKSENEQEKYVRLFI-------------VIPKTATEE 136
            ..:                     ..||....:::..:..::.             ..|...:::
  Fly   172 TRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDD 236

  Fly   137 DIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVAFENCSAKYKAVFAEPKGSTRTQ 201
            .:.:.|.|:|.::.|.:.|:      |||.:::|.....||.|.|:                   
  Fly   237 LMHKHFVQFGPIQDVRVFKD------KGFSFIKFVTKEAAAHAIEH------------------- 276

  Fly   202 RDQYGRPSEDNPLYSSSGRGN--SNFNGGGSSSGGGGSNSYNN 242
                        .::|...||  ..|.|    ...||.||.||
  Fly   277 ------------THNSEVHGNLVKCFWG----KENGGDNSANN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 27/63 (43%)
RRM2_RBM45 122..195 CDD:240813 14/85 (16%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 41/172 (24%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799 27/62 (44%)
RRM3_TIA1_like 221..294 CDD:240800 19/113 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.