DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and cocoon

DIOPT Version :10

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster


Alignment Length:194 Identity:50/194 - (25%)
Similarity:83/194 - (42%) Gaps:34/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVL 103
            ||:|.||.|..||::....:.||..:..:||..:|:|.    :...|..:..|......|..:|.
  Fly   119 TEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFG----SYDVQMHVLSKRHSIDGRWCEVK 179

  Fly   104 VAANRNQGSNKSENEQEKYVRLFIVIPKTATE----EDIREEFSQWGDVESVTIVKEKNNGNP-K 163
            |.|:|..|:.:..       ::|:   ...||    :|:||.||::|:|..|.|.|      | :
  Fly   180 VPASRGMGNQEPG-------KVFV---GRCTEDIEADDLREYFSKFGEVIDVFIPK------PFR 228

  Fly   164 GFGYVRFTKFYYAAVAFENCSAKYKAVFAEPKGSTRTQRDQYGRPSEDNPLYSSSGRGN--SNF 225
            .|.:|.|...|...|.   |..|:.........||..:::...:    |.|:.::...|  :||
  Fly   229 AFSFVTFLDPYVPRVV---CGEKHIIKGVSVHVSTADKKNVQNK----NQLFQTNNYNNLDNNF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:409801 18/65 (28%)
RRM_SF 122..195 CDD:473069 21/77 (27%)
RRM3_RBM45 267..339 CDD:409803
RRM4_RBM45 383..449 CDD:409804
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 18/65 (28%)
RRM2_TDP43 193..262 CDD:409761 23/80 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.