DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and sf3b4

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_989116.1 Gene:sf3b4 / 394721 XenbaseID:XB-GENE-492933 Length:388 Species:Xenopus tropicalis


Alignment Length:197 Identity:51/197 - (25%)
Similarity:90/197 - (45%) Gaps:32/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNG-KTIGKMDRTLKVLVAANR 108
            |.|...|.:.:..:.||:.|.:::|..:|:|....||..|.:.||. |..||..|..|. .|.|:
 Frog    31 ELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKA-SAHNK 94

  Fly   109 N--QGSNKSENEQEKYVRLFI-VIPKTATEEDIREEFSQWGDV-ESVTIVKEKNNGNPKGFGYVR 169
            |  .|:|           :|| .:.....|:.:.:.||.:|.: ::..|:::.:.||.||:.::.
 Frog    95 NLDVGAN-----------IFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFIN 148

  Fly   170 FTKFYYAAVAFENCSAKY------KAVFAEPKGSTRTQRDQYGRPSE-----DNPLYSSSGRGNS 223
            |..|..:..|.|..:.:|      ...:|..|.|   :.:::|..:|     .||| |.:.|.:.
 Frog   149 FASFDASDAAIEAMNGQYLCNRPITVSYAFKKDS---KGERHGSAAERLLAAQNPL-SQADRPHQ 209

  Fly   224 NF 225
            .|
 Frog   210 LF 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 19/60 (32%)
RRM2_RBM45 122..195 CDD:240813 17/80 (21%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
sf3b4NP_989116.1 RRM1_SF3B4 15..88 CDD:240780 18/56 (32%)
RRM2_SF3B4 99..181 CDD:240781 19/92 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.