Sequence 1: | NP_647887.1 | Gene: | CG1316 / 38526 | FlyBaseID: | FBgn0035526 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_989116.1 | Gene: | sf3b4 / 394721 | XenbaseID: | XB-GENE-492933 | Length: | 388 | Species: | Xenopus tropicalis |
Alignment Length: | 197 | Identity: | 51/197 - (25%) |
---|---|---|---|
Similarity: | 90/197 - (45%) | Gaps: | 32/197 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 EAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNG-KTIGKMDRTLKVLVAANR 108
Fly 109 N--QGSNKSENEQEKYVRLFI-VIPKTATEEDIREEFSQWGDV-ESVTIVKEKNNGNPKGFGYVR 169
Fly 170 FTKFYYAAVAFENCSAKY------KAVFAEPKGSTRTQRDQYGRPSE-----DNPLYSSSGRGNS 223
Fly 224 NF 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1316 | NP_647887.1 | RRM1_RBM45 | 25..105 | CDD:240812 | 19/60 (32%) |
RRM2_RBM45 | 122..195 | CDD:240813 | 17/80 (21%) | ||
RRM3_RBM45 | 267..339 | CDD:240814 | |||
RRM4_RBM45 | 383..449 | CDD:240815 | |||
sf3b4 | NP_989116.1 | RRM1_SF3B4 | 15..88 | CDD:240780 | 18/56 (32%) |
RRM2_SF3B4 | 99..181 | CDD:240781 | 19/92 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |