DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and tardbp

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:XP_012821726.1 Gene:tardbp / 394651 XenbaseID:XB-GENE-974453 Length:418 Species:Xenopus tropicalis


Alignment Length:229 Identity:67/229 - (29%)
Similarity:96/229 - (41%) Gaps:63/229 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVL 103
            ||:|.::.||.:||:..:.|.||..|..:||..:|:|:                    |...:|.
 Frog   126 TEQDLKDYFSTFGEVIMVQVKKDAKTGHSKGFGFVRFA--------------------DYETQVK 170

  Fly   104 VAANRNQ----------GSNKSENEQEKYVRLFIVIPKTATE----EDIREEFSQWGDVESVTIV 154
            |.:.|:.          .::||.:|..:..::|:   ...||    |::|:.|||:|:|..|.| 
 Frog   171 VMSQRHMIDGRWCDCKLPNSKSPDEPMRSRKVFV---GRCTEDMSAEELRQFFSQYGEVVDVFI- 231

  Fly   155 KEKNNGNPKGFGYVRFTKFYYAAVAFENCSAK--YKAV-----FAEPKGSTRTQRDQYGR---PS 209
                   ||.|....|..|....||...|...  .|.|     .||||.:...|.::.||   ||
 Frog   232 -------PKPFRAFAFVTFADDQVAQSLCGEDLIIKGVSVHVSTAEPKHNNNRQLERGGRFPGPS 289

  Fly   210 EDNPLY-----SSSGRGNSNFNGGGSSSGGGGSN 238
            ..|..|     ||...||   |.||:..||||.|
 Frog   290 FGNQGYPNSRPSSGALGN---NQGGNMGGGGGMN 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 17/65 (26%)
RRM2_RBM45 122..195 CDD:240813 24/83 (29%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
tardbpXP_012821726.1 RRM <87..232 CDD:223796 34/136 (25%)
RRM1_TDP43 115..191 CDD:240767 19/84 (23%)
RRM <190..>299 CDD:223796 36/119 (30%)
RRM2_TDP43 200..270 CDD:240768 22/80 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.