DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and lark

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster


Alignment Length:237 Identity:55/237 - (23%)
Similarity:85/237 - (35%) Gaps:53/237 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RLFI--ICNKAHTEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGK 91
            :|||  :..|....| .|..|..||.:.:..|||      |.|  :|..........|.:.:||.
  Fly     8 KLFIGNLDEKTQATE-LRALFEKYGTVVECDVVK------NYG--FVHMETEQQGRDAIQNLNGY 63

  Fly    92 TIGKMDRTLKVLVAANRNQGSNKSENEQEKYVRLFI--VIPKTATEEDIREEFSQWGDVESVTIV 154
            |:.:.  .:||..|.:|...:..:       .::|:  :..||...| :||.|.::|.|....||
  Fly    64 TLNEF--AIKVEAAKSRRAPNTPT-------TKIFVGNLTDKTRAPE-VRELFQKYGTVVECDIV 118

  Fly   155 KEKNNGNPKGFGYV-----------------RFTKFYYAAVAFENCSAKYKAVFAEPKGSTRTQR 202
                    :.:|:|                 |........|.......:.|....:|:...|..|
  Fly   119 --------RNYGFVHLDCVGDVQDAIKELNGRVVDGQPLKVQVSTSRVRPKPGMGDPEQCYRCGR 175

  Fly   203 DQYGRPSEDNP-LYSSSGRGNSNFNGGGSSSGGGGSNSYNND 243
            .  |..|::.| ||.|:|.|..  .....|:||.....|..|
  Fly   176 S--GHWSKECPRLYGSAGGGRE--PPSPLSAGGYRDRMYGRD 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 21/77 (27%)
RRM2_RBM45 122..195 CDD:240813 16/91 (18%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 20/75 (27%)
RRM1_2_CoAA_like 87..152 CDD:409779 14/73 (19%)
hnRNP-R-Q <88..>258 CDD:273732 32/139 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.