DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and fne

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster


Alignment Length:407 Identity:86/407 - (21%)
Similarity:155/407 - (38%) Gaps:118/407 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RSGGGRGGQEYSNDDDPPMSRLFIICN---KAHTEEDFREAFSPYGEIEDIWVVKDK-------- 62
            ::|...|..:.|||:    ||..:|.|   :..|:|:.|..||..||:|...:|:||        
  Fly     9 KNGSANGSVDGSNDE----SRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLP 69

  Fly    63 ----------HTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVLVAANRNQGSNKSEN 117
                      ...::.|..:|.:.:..||.||...:||..:  .::.:||..|        :..:
  Fly    70 ASLTALNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLRL--QNKVIKVSYA--------RPSS 124

  Fly   118 EQEKYVRLFIV-IPKTATEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVAFE 181
            |..|...|::. :||..::.|:...|:.:|.:.:..|:.:..:|..||.|::||.:...|..|.:
  Fly   125 ESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQ 189

  Fly   182 NCSAKYKAVFAE---------------------------PKGSTRTQRDQYGRPSEDNPLYSSSG 219
            ..:.|....:||                           |:.:..|:|.....||.....||...
  Fly   190 ELNGKTPKGYAEPITVKFANNPSNSAKAQIAPPLTAYLTPQAAAATRRLAGALPSAGRIRYSPLA 254

  Fly   220 RGNSNFNG---GGSSSGGGGSNSYNNDWNVSQNNDMAAFLRMQNVPVAQPSCLEV-NVSNCVNQD 280
             |:...|.   |.:.:|.|        |                       |:.| |::....::
  Fly   255 -GDLLANSILPGNAMTGSG--------W-----------------------CIFVYNLAPETEEN 287

  Fly   281 QLWRLFDIIPGLDYCQIMREHGPRTNE----ALVVYDNPEAAIYAKDKLHGLEYPMGERIIVKVN 341
            .||:||.....:...:::|:  .:|::    ..|...|.:.|:.|...|:|  |.:|.|:     
  Fly   288 VLWQLFGPFGAVQSVKVIRD--LQTSKCKGFGFVTMTNYDEAVVAIQSLNG--YTLGNRV----- 343

  Fly   342 GMSSARMDTSFIDKRTK 358
                  :..||...:||
  Fly   344 ------LQVSFKTNKTK 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 25/100 (25%)
RRM2_RBM45 122..195 CDD:240813 18/100 (18%)
RRM3_RBM45 267..339 CDD:240814 18/76 (24%)
RRM4_RBM45 383..449 CDD:240815
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 79/391 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.