DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and Spx

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster


Alignment Length:149 Identity:37/149 - (24%)
Similarity:64/149 - (42%) Gaps:19/149 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNG-KTIGKMDRTLKVLV-AAN 107
            |.|...|.:.::.:.||:.||.::|..:|:|....||....:.||. |..||..|..|... ..|
  Fly    31 ELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMNMIKLYGKPIRVNKASAHQKN 95

  Fly   108 RNQGSNKSENEQEKYVRLFIVIPKTATEED---IREEFSQWGDV-ESVTIVKEKNNGNPKGFGYV 168
            .:.|:|             |.|.....|.|   :.:.||.:|.: ::..|:::...|..|.|.::
  Fly    96 LDVGAN-------------IFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFI 147

  Fly   169 RFTKFYYAAVAFENCSAKY 187
            .|..|..:..|.:..:.:|
  Fly   148 NFASFEASDAAMDAMNGQY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 19/61 (31%)
RRM2_RBM45 122..195 CDD:240813 15/70 (21%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 18/56 (32%)
RRM2_SF3B4 99..181 CDD:240781 17/81 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.