DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and ELAVL1

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001410.2 Gene:ELAVL1 / 1994 HGNCID:3312 Length:326 Species:Homo sapiens


Alignment Length:336 Identity:71/336 - (21%)
Similarity:136/336 - (40%) Gaps:89/336 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVL 103
            |:::.|..||..||:|...:::||....:.|..:|.:....||.:|...:||..:  ..:|:||.
Human    32 TQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRL--QSKTIKVS 94

  Fly   104 VAANRNQGSNKSENEQEKYVRLFIV-IPKTATEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGY 167
            .|        :..:|..|...|:|. :|:|.|::|:.:.||::|.:.:..::.::..|..:|..:
Human    95 YA--------RPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAF 151

  Fly   168 VRFTKFYYAAVAFENCSAKYKAVFAEPKGSTRTQRDQY-GRPSED------NPLYSSSGR----- 220
            :||.|...|..|..:.:..      :|.||:.....:: ..|:::      :.||.|..|     
Human   152 IRFDKRSEAEEAITSFNGH------KPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGP 210

  Fly   221 -------------------GNSNFNGGGSSSGGGGSNSYNNDWNVSQNNDMAAFLRMQNVPVAQP 266
                               |.|..|..|::|.|         |                      
Human   211 VHHQAQRFRFSPMGVDHMSGLSGVNVPGNASSG---------W---------------------- 244

  Fly   267 SCLEV-NVSNCVNQDQLWRLFDIIPGLDYCQIMREHGPRTNE----ALVVYDNPEAAIYAKDKLH 326
             |:.: |:....::..||::|.....:...:::|:.  .||:    ..|...|.|.|..|...|:
Human   245 -CIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDF--NTNKCKGFGFVTMTNYEEAAMAIASLN 306

  Fly   327 GLEYPMGERII 337
            |  |.:|::|:
Human   307 G--YRLGDKIL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 19/65 (29%)
RRM2_RBM45 122..195 CDD:240813 16/73 (22%)
RRM3_RBM45 267..339 CDD:240814 18/76 (24%)
RRM4_RBM45 383..449 CDD:240815
ELAVL1NP_001410.2 ELAV_HUD_SF 19..326 CDD:273741 71/336 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.