DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and MSI2

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:XP_005257071.1 Gene:MSI2 / 124540 HGNCID:18585 Length:346 Species:Homo sapiens


Alignment Length:178 Identity:44/178 - (24%)
Similarity:73/178 - (41%) Gaps:39/178 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SGGGRGGQEYSNDDDPPMSRLFIICNKAHTEED-FREAFSPYGEIEDIWVVKDKHTQENKGIAYV 73
            :.|.:|....:||......::||......|..| .|:.||.:|||.:..|::|..|:.::|..:|
Human     3 ANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFV 67

  Fly    74 KFSKTSDAAKA----QEEMNGKTIG-----------KM-DRTLKVLVAANRNQGSNKSENEQEKY 122
            .|:..:...|.    ..|::.|||.           || .||.|:.|..                
Human    68 TFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGG---------------- 116

  Fly   123 VRLFIVIPKTATEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRF 170
                  :......||:::.|.|:|.||...::.:|.....:|||:|.|
Human   117 ------LSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTF 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 26/96 (27%)
RRM2_RBM45 122..195 CDD:240813 13/49 (27%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
MSI2XP_005257071.1 RRM1_MSI2 17..109 CDD:410153 23/91 (25%)
PABP-1234 <35..343 CDD:130689 37/146 (25%)
RRM2_MSI 111..184 CDD:240769 15/70 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.