powered by:
Protein Alignment CG1316 and LOC100486202
DIOPT Version :9
Sequence 1: | NP_647887.1 |
Gene: | CG1316 / 38526 |
FlyBaseID: | FBgn0035526 |
Length: | 470 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002940968.3 |
Gene: | LOC100486202 / 100486202 |
-ID: | - |
Length: | 763 |
Species: | Xenopus tropicalis |
Alignment Length: | 62 |
Identity: | 17/62 - (27%) |
Similarity: | 25/62 - (40%) |
Gaps: | 10/62 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 AKAQEEMNGK-TIGKMDRTLKVLVAANRNQGSNKSENEQEKYVRLFIVIPKTATEEDIREEF 142
|:.|..:|.| ...:|.:.||..|.....:...||.|:: |||...:...|.||
Frog 87 AEQQTVLNYKQQKAEMCKNLKRTVLLKNEKTMIKSGNQE---------IPKLPAQSTKRSEF 139
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
75 |
1.000 |
Domainoid score |
I8928 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
273 |
1.000 |
Inparanoid score |
I2919 |
OMA |
1 |
1.010 |
- |
- |
|
QHG48842 |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0007975 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto104981 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5751 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X5918 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
9 | 9.000 |
|
Return to query results.
Submit another query.