DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and LOC100486202

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:XP_002940968.3 Gene:LOC100486202 / 100486202 -ID:- Length:763 Species:Xenopus tropicalis


Alignment Length:62 Identity:17/62 - (27%)
Similarity:25/62 - (40%) Gaps:10/62 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 AKAQEEMNGK-TIGKMDRTLKVLVAANRNQGSNKSENEQEKYVRLFIVIPKTATEEDIREEF 142
            |:.|..:|.| ...:|.:.||..|.....:...||.|::         |||...:...|.||
 Frog    87 AEQQTVLNYKQQKAEMCKNLKRTVLLKNEKTMIKSGNQE---------IPKLPAQSTKRSEF 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 7/23 (30%)
RRM2_RBM45 122..195 CDD:240813 6/21 (29%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
LOC100486202XP_002940968.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I8928
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 273 1.000 Inparanoid score I2919
OMA 1 1.010 - - QHG48842
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007975
OrthoInspector 1 1.000 - - oto104981
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5751
SonicParanoid 1 1.000 - - X5918
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.