DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srw and twsg1a

DIOPT Version :9

Sequence 1:NP_647886.2 Gene:srw / 38525 FlyBaseID:FBgn0261952 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_571872.2 Gene:twsg1a / 84037 ZFINID:ZDB-GENE-010509-2 Length:217 Species:Danio rerio


Alignment Length:137 Identity:46/137 - (33%)
Similarity:62/137 - (45%) Gaps:35/137 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NMAQMRKKSHTEE-FEGMPALFRAMS--SSPNDGYTYNWSVVSF--------------------- 60
            |.:....||..|| :..:|:||||::  .:|     .|..||||                     
Zfish    84 NDSPATSKSTVEELYRPIPSLFRALTEGDAP-----INMMVVSFPVAEELSHHENLVSFLETLDS 143

  Fly    61 -STN-GKPGSGLN----CTVLYLDQCTSWNKCRQTCLKTGATSYRWFHDGCCECVGELCMNYGVN 119
             |.| ..|.|...    |||:|.|.|.|..:|:|.|...|.:.|||||:.||||:|..|::||..
Zfish   144 QSQNISLPTSSAQDDALCTVVYFDDCVSIRQCKQYCESMGGSKYRWFHNACCECIGPECLDYGSK 208

  Fly   120 ESRCRLC 126
            ..:|..|
Zfish   209 TVKCMNC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srwNP_647886.2 Tsg 26..127 CDD:282516 45/131 (34%)
twsg1aNP_571872.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1254178at2759
OrthoFinder 1 1.000 - - FOG0003932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12312
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.