DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srw and TWSG1

DIOPT Version :9

Sequence 1:NP_647886.2 Gene:srw / 38525 FlyBaseID:FBgn0261952 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_065699.1 Gene:TWSG1 / 57045 HGNCID:12429 Length:223 Species:Homo sapiens


Alignment Length:136 Identity:44/136 - (32%)
Similarity:66/136 - (48%) Gaps:40/136 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KSHTEEF-EGMPALFRAMSSSPNDGYT-YNWSVVSFSTNGK------------------------ 65
            ||..||. |.:|:||||::    :|.| .||::|||....:                        
Human    90 KSTVEELHEPIPSLFRALT----EGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSV 150

  Fly    66 PGSGLN----------CTVLYLDQCTSWNKCRQTCLKTGATSYRWFHDGCCECVGELCMNYGVNE 120
            |.:.::          |||:|.|.|.|.::|:.:|...||:.|||||:.||||:|..|::||...
Human   151 PSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKT 215

  Fly   121 SRCRLC 126
            .:|..|
Human   216 VKCMNC 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srwNP_647886.2 Tsg 26..127 CDD:282516 44/136 (32%)
TWSG1NP_065699.1 Tsg 88..222 CDD:282516 44/136 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149656
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28J21
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6699
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1254178at2759
OrthoFinder 1 1.000 - - FOG0003932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12312
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.