DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srw and twsg2

DIOPT Version :9

Sequence 1:NP_647886.2 Gene:srw / 38525 FlyBaseID:FBgn0261952 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001015756.1 Gene:twsg2 / 548473 XenbaseID:XB-GENE-487717 Length:244 Species:Xenopus tropicalis


Alignment Length:158 Identity:55/158 - (34%)
Similarity:68/158 - (43%) Gaps:45/158 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLSFGEL--------GLANMAQMRKK-----SHTEEFE-GMPALFRAMSSSPNDGYTYNW----- 55
            ||..|.|        ||.:..:..||     |..||.. .:|:||||:||.........|     
 Frog    75 LLCMGSLWDQCCDCVGLCSKNKESKKHSARRSSLEELPVSVPSLFRAVSSMQEGESALGWTAHNL 139

  Fly    56 --------------------SVVSFS--TNGKPGSGLNCTVLYLDQCTSWNKCRQTCLKTGATSY 98
                                |||:.|  ||   .|| :|||||.:.|.|..:|.|:|...|:..|
 Frog   140 PILEELAQSTHMDHILLGAHSVVTASPLTN---ISG-SCTVLYFNPCMSMRRCHQSCESVGSPRY 200

  Fly    99 RWFHDGCCECVGELCMNYGVNESRCRLC 126
            ||||:|||:|||..|..||..|..|..|
 Frog   201 RWFHNGCCQCVGPDCHGYGSKEPLCLQC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srwNP_647886.2 Tsg 26..127 CDD:282516 49/134 (37%)
twsg2NP_001015756.1 Tsg 103..228 CDD:368047 46/128 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1254178at2759
OrthoFinder 1 1.000 - - FOG0003932
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12312
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.