DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1273 and FNDC1

DIOPT Version :9

Sequence 1:NP_647883.1 Gene:CG1273 / 38522 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster
Sequence 2:NP_115921.2 Gene:FNDC1 / 84624 HGNCID:21184 Length:1894 Species:Homo sapiens


Alignment Length:327 Identity:90/327 - (27%)
Similarity:116/327 - (35%) Gaps:83/327 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 NPLLRSHSADEEPDIDVENAPVI---------QGSFEGSFEITKTDADIARKKTPPTRAYQAASS 363
            |||......|....:|:|..||:         ||                |..||...|......
Human  1379 NPLRIKLGGDGRTIVDLEGTPVVSPDGLPLFGQG----------------RHGTPLANAQDKPIL 1427

  Fly   364 TLPPKAIAVTPFSLRVKPKKPSIEKLTTVLPQQLPTGGPISSTRATTKATKATTTTTKRTTTSTT 428
            :|..|.:.    .|.|..|               .|..|.::.:.||..|...||||.|.||:||
Human  1428 SLGGKPLV----GLEVIKK---------------TTHPPTTTMQPTTTTTPLPTTTTPRPTTATT 1473

  Fly   429 RKTTT---TTTPKPTTTTTTTEATTTTTTST-TTTTPPLPPSTTRATTTSTNTFTYPSVNTPPPN 489
            |:|||   |||.:||||..||..||||||.| ||..|..||.|........|...          
Human  1474 RRTTTTRRTTTRRPTTTVRTTTRTTTTTTPTPTTPIPTCPPGTLERHDDDGNLIM---------- 1528

  Fly   490 QGGSLPKLDANLFTTFPILDTQPWRP------MHREVPELLPGPPPAFPTKTLPGGTTPTVNHIP 548
            ....:|:..|. ...|..|:|....|      ::.|..|.....|   ||.|.|..|..|...||
Human  1529 SSNGIPECYAE-EDEFSGLETDTAVPTEEAYVIYDEDYEFETSRP---PTTTEPSTTATTPRVIP 1589

  Fly   549 QRRI------DEFELP----FIAD-----NPTPPTAAVAPVTVDPYSLGFLNPGLRVQEPKPNLG 598
            :...      :||:|.    |:|.     |..|.........:|.:.:..|:..:.....|.:|.
Human  1590 EEGAISSFPEEEFDLAGRKRFVAPYVTYLNKDPSAPCSLTDALDHFQVDSLDEIIPNDLKKSDLP 1654

  Fly   599 PQ 600
            ||
Human  1655 PQ 1656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1273NP_647883.1 None
FNDC1NP_115921.2 FN3 40..120 CDD:214495
FN3 158..241 CDD:214495
FN3 261..354 CDD:238020
FN3 362..452 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..500
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 515..1271
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1311..1350
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1444..1515 38/70 (54%)
FN3 1658..1749 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23197
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.