DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-a and AT4G26710

DIOPT Version :9

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a / 38521 FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_194401.1 Gene:AT4G26710 / 828778 AraportID:AT4G26710 Length:70 Species:Arabidopsis thaliana


Alignment Length:54 Identity:27/54 - (50%)
Similarity:32/54 - (59%) Gaps:5/54 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VGIAMPIMT----PKGPHQNLIRCILMLTA-ACCWLFWLCCYMAQMNPLIGPKL 66
            |||...|.|    .|||..||:...|::|| .|||:.|...|:|||||||.|.|
plant    13 VGIIASICTRICFNKGPSTNLLHLTLVITATVCCWMMWAIVYIAQMNPLIVPIL 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:398897 25/51 (49%)
AT4G26710NP_194401.1 ATP_synt_H 3..65 CDD:398897 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4362
eggNOG 1 0.900 - - E1_KOG3500
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I2631
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1613627at2759
OrthoFinder 1 1.000 - - FOG0001872
OrthoInspector 1 1.000 - - otm2716
orthoMCL 1 0.900 - - OOG6_102348
Panther 1 1.100 - - O PTHR12263
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1797
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.