powered by:
Protein Alignment VhaM9.7-a and atp6v0e1
DIOPT Version :9
Sequence 1: | NP_001097499.1 |
Gene: | VhaM9.7-a / 38521 |
FlyBaseID: | FBgn0035521 |
Length: | 85 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001006038.2 |
Gene: | atp6v0e1 / 450017 |
ZFINID: | ZDB-GENE-041010-133 |
Length: | 81 |
Species: | Danio rerio |
Alignment Length: | 71 |
Identity: | 31/71 - (43%) |
Similarity: | 44/71 - (61%) |
Gaps: | 0/71 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 VLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVVA 72
:...|.|||.||..:|...|||.::.:|..:|:|||.||:||||...::|:|||.||.||.|.:.
Zfish 10 IAVMTLLWGLVGGVIPWFIPKGANRGVIVTMLVLTAVCCYLFWLIAILSQLNPLFGPVLKNDTIW 74
Fly 73 MIGRSW 78
.:...|
Zfish 75 YLYYHW 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170586680 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1613627at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.940 |
|
Return to query results.
Submit another query.