DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-a and VhaM9.7-d

DIOPT Version :9

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a / 38521 FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_650578.1 Gene:VhaM9.7-d / 42041 FlyBaseID:FBgn0038458 Length:88 Species:Drosophila melanogaster


Alignment Length:80 Identity:25/80 - (31%)
Similarity:46/80 - (57%) Gaps:3/80 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AFFPVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKR 68
            ||..:..|..|:..:|.   :::.:...:.||||.::|||.||:|.|:..::.|:|||.||:.|:
  Fly     6 AFMVITVFWLLFAIIGF---LVSYRYEERGLIRCCVILTAVCCYLAWMVTFVMQLNPLTGPRAKQ 67

  Fly    69 DVVAMIGRSWNNPIV 83
            .::..:...|...|:
  Fly    68 KIILGMITYWPRSII 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:398897 19/57 (33%)
VhaM9.7-dNP_650578.1 ATP_synt_H 7..64 CDD:283211 20/59 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449715
Domainoid 1 1.000 43 1.000 Domainoid score I3641
eggNOG 1 0.900 - - E1_KOG3500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2878
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1613627at2759
OrthoFinder 1 1.000 - - FOG0001872
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102348
Panther 1 1.100 - - P PTHR12263
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2893
SonicParanoid 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.