DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-a and VhaM9.7-b

DIOPT Version :9

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a / 38521 FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001262170.1 Gene:VhaM9.7-b / 40389 FlyBaseID:FBgn0028663 Length:89 Species:Drosophila melanogaster


Alignment Length:74 Identity:37/74 - (50%)
Similarity:51/74 - (68%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVVAM 73
            :..|::|..:||..|... :||::.:.:|.||||||.||||||||||.|:||||||||..:.:.:
  Fly     9 IVITSIWAFIGIICPFFA-RGPNRGVTQCCLMLTAATCWLFWLCCYMTQLNPLIGPKLSMNEIMI 72

  Fly    74 IGRSWNNPI 82
            :.|.|.|.|
  Fly    73 MAREWGNEI 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:398897 30/55 (55%)
VhaM9.7-bNP_001262170.1 ATP_synt_H 9..64 CDD:398897 30/55 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449714
Domainoid 1 1.000 50 1.000 Domainoid score I4362
eggNOG 1 0.900 - - E1_KOG3500
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I2631
Isobase 1 0.950 - 0 Normalized mean entropy S2878
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1613627at2759
OrthoFinder 1 1.000 - - FOG0001872
OrthoInspector 1 1.000 - - otm26584
orthoMCL 1 0.900 - - OOG6_102348
Panther 1 1.100 - - P PTHR12263
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2893
SonicParanoid 1 1.000 - - X1797
1312.780

Return to query results.
Submit another query.