DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-a and VMA9

DIOPT Version :9

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a / 38521 FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_958835.1 Gene:VMA9 / 2732686 SGDID:S000028508 Length:73 Species:Saccharomyces cerevisiae


Alignment Length:63 Identity:17/63 - (26%)
Similarity:35/63 - (55%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AAFFPVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPK 65
            ::|:.|:....:...:.:...||.||. :|.:.|..::||.|..:|.|...::.|::||:.|:
Yeast     2 SSFYTVVGVFIVVSAMSVLFWIMAPKN-NQAVWRSTVILTLAMMFLMWAITFLCQLHPLVAPR 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:398897 15/57 (26%)
VMA9NP_958835.1 ATP_synt_H 6..63 CDD:398897 15/57 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001872
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102348
Panther 1 1.100 - - LDO PTHR12263
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2893
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.900

Return to query results.
Submit another query.