DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-a and vha-17

DIOPT Version :9

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a / 38521 FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_501636.2 Gene:vha-17 / 177757 WormBaseID:WBGene00009882 Length:86 Species:Caenorhabditis elegans


Alignment Length:74 Identity:26/74 - (35%)
Similarity:48/74 - (64%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVV 71
            |::..:|.|..:|...|.:.||||::.:|:.::::||.|||:||:..::.|:||||||::....:
 Worm     6 PLVSVSAFWAIIGFGGPWIVPKGPNRGIIQLMIIMTAVCCWMFWIMVFLHQLNPLIGPQINVKTI 70

  Fly    72 AMIGRSWNN 80
            ..|...|.:
 Worm    71 RWISEKWGD 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:398897 23/57 (40%)
vha-17NP_501636.2 ATP_synt_H 6..64 CDD:283211 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159619
Domainoid 1 1.000 69 1.000 Domainoid score I6287
eggNOG 1 0.900 - - E1_KOG3500
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I3806
Isobase 1 0.950 - 0 Normalized mean entropy S2878
OMA 1 1.010 - - QHG49180
OrthoDB 1 1.010 - - D1613627at2759
OrthoFinder 1 1.000 - - FOG0001872
OrthoInspector 1 1.000 - - otm14171
orthoMCL 1 0.900 - - OOG6_102348
Panther 1 1.100 - - LDO PTHR12263
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2893
SonicParanoid 1 1.000 - - X1797
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.