DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-a and Atp6v0e

DIOPT Version :9

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a / 38521 FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_079548.1 Gene:Atp6v0e / 11974 MGIID:1328318 Length:81 Species:Mus musculus


Alignment Length:72 Identity:28/72 - (38%)
Similarity:46/72 - (63%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVV 71
            |::..:..||.||:.:|...||||::.:|..:|:..:.||:||||...:||:|||.||:||.:.:
Mouse     9 PLIVMSVFWGFVGLLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNETI 73

  Fly    72 AMIGRSW 78
            ..:...|
Mouse    74 WYLKYHW 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:398897 24/57 (42%)
Atp6v0eNP_079548.1 ATP_synt_H 9..67 CDD:398897 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842277
Domainoid 1 1.000 79 1.000 Domainoid score I8637
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5178
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49180
OrthoDB 1 1.010 - - D1613627at2759
OrthoFinder 1 1.000 - - FOG0001872
OrthoInspector 1 1.000 - - mtm8760
orthoMCL 1 0.900 - - OOG6_102348
Panther 1 1.100 - - LDO PTHR12263
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2893
SonicParanoid 1 1.000 - - X1797
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.900

Return to query results.
Submit another query.