powered by:
Protein Alignment VhaM9.7-a and Atp6v0e
DIOPT Version :9
Sequence 1: | NP_001097499.1 |
Gene: | VhaM9.7-a / 38521 |
FlyBaseID: | FBgn0035521 |
Length: | 85 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_079548.1 |
Gene: | Atp6v0e / 11974 |
MGIID: | 1328318 |
Length: | 81 |
Species: | Mus musculus |
Alignment Length: | 72 |
Identity: | 28/72 - (38%) |
Similarity: | 46/72 - (63%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 PVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVV 71
|::..:..||.||:.:|...||||::.:|..:|:..:.||:||||...:||:|||.||:||.:.:
Mouse 9 PLIVMSVFWGFVGLLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNETI 73
Fly 72 AMIGRSW 78
..:...|
Mouse 74 WYLKYHW 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167842277 |
Domainoid |
1 |
1.000 |
79 |
1.000 |
Domainoid score |
I8637 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
82 |
1.000 |
Inparanoid score |
I5178 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG49180 |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1613627at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001872 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm8760 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102348 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR12263 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2893 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1797 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
14 | 13.900 |
|
Return to query results.
Submit another query.