powered by:
Protein Alignment VhaM9.7-a and atp6v0e2
DIOPT Version :9
Sequence 1: | NP_001097499.1 |
Gene: | VhaM9.7-a / 38521 |
FlyBaseID: | FBgn0035521 |
Length: | 85 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001165046.1 |
Gene: | atp6v0e2 / 100124803 |
XenbaseID: | XB-GENE-5771814 |
Length: | 81 |
Species: | Xenopus tropicalis |
Alignment Length: | 72 |
Identity: | 33/72 - (45%) |
Similarity: | 48/72 - (66%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 PVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVV 71
|::.||..||.:|||.|...||||::.:|..:|:.||.||::|||...:||:|||.||:||.|.:
Frog 9 PMIIFTTFWGLIGIAAPWFVPKGPNRGVIITMLVTTAVCCYIFWLVAILAQLNPLFGPQLKNDTI 73
Fly 72 AMIGRSW 78
..:...|
Frog 74 WYVRFLW 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1613627at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.