DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11586 and SNU23

DIOPT Version :9

Sequence 1:NP_001261410.1 Gene:CG11586 / 38520 FlyBaseID:FBgn0035520 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_010185.1 Gene:SNU23 / 851460 SGDID:S000002256 Length:194 Species:Saccharomyces cerevisiae


Alignment Length:206 Identity:53/206 - (25%)
Similarity:87/206 - (42%) Gaps:39/206 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RRKWDKNEYEKLAAERLLNQVAPKEEEPVQRENLKRRDYKVDLDSKLGKSVVINKNTPTSQSG-- 71
            ||.||:.||.:.|.....::.......|::.:.||.:....|...| |....:||...|:.:.  
Yeast     6 RRTWDREEYAEQARSGYDDRSLKATLTPIELQALKSKYTNYDHLIK-GSLKDLNKRKLTANTESL 69

  Fly    72 ---------GYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMKVE-----------RSTVDQVK 116
                     |:||::|:...||::.::||:|.|.|      ::|.|           |...|..:
Yeast    70 SSFKRGKKFGFYCDICNLTFKDTLQYIDHLNHKVH------AIKFENLFDEPLIIDIRDNDDVPQ 128

  Fly   117 ERFQQNKKKMEEKQKDYELERRLREAKEEEDRYKEHRKEKRKERKRKAEDTDFESGGMPDDMAAI 181
            |.|:.....:   .||: :|.|..|.:.:..|..:...||   .|:.|.....||   ...::.:
Yeast   129 EEFELCYHNL---IKDF-VEVRSMETQSKRKRLLDTDVEK---AKKVATKPSIES---ESKVSQM 183

  Fly   182 MGFSGFGGSKK 192
            ||||.|..|||
Yeast   184 MGFSNFATSKK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11586NP_001261410.1 ZnF_U1 70..101 CDD:197732 11/41 (27%)
SNU23NP_010185.1 zf-met 80..104 CDD:403930 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4727
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I1826
Isobase 1 0.950 - 0 Normalized mean entropy S1646
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004950
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103136
Panther 1 1.100 - - LDO PTHR45986
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1367
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.