DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11586 and zmat2

DIOPT Version :9

Sequence 1:NP_001261410.1 Gene:CG11586 / 38520 FlyBaseID:FBgn0035520 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001005119.1 Gene:zmat2 / 448699 XenbaseID:XB-GENE-1217476 Length:199 Species:Xenopus tropicalis


Alignment Length:190 Identity:127/190 - (66%)
Similarity:158/190 - (83%) Gaps:7/190 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DHRRKWDKNEYEKLAAERLLNQVAPKEEEPVQ---RENLKRRDYKVDLDSKLGKSVVINKNTPTS 68
            |.||||||:|||:||.:|:..:...|:.:|:|   ||.|:.|||||||:|||||::||.|.||.|
 Frog    11 DFRRKWDKDEYEQLAQKRITEEREKKDGKPLQPIKRELLRHRDYKVDLESKLGKTIVITKTTPQS 75

  Fly    69 QSGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMKVERSTVDQVKERFQQNKKKMEEKQKDY 133
            :.|||||||||||||||||||||||||||||||||||:|||||:||||:||:.||||||||||||
 Frog    76 EMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQVKKRFEVNKKKMEEKQKDY 140

  Fly   134 ELERRLREAKEEEDRYKEHRKEKRKERKRKA-EDTDFESGGMPDDMAAIMGFSGFGGSKK 192
            :.|.|::|.:|||::.:.::|||::|:|||| ||..||.   .|:|||:|||||||.|||
 Frog   141 DFEERMKELREEEEKARAYKKEKQREKKRKAEEDLGFEE---DDEMAAVMGFSGFGSSKK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11586NP_001261410.1 ZnF_U1 70..101 CDD:197732 29/30 (97%)
zmat2NP_001005119.1 ZnF_U1 77..108 CDD:197732 29/30 (97%)
DUF1777 178..>196 CDD:370033 12/20 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5563
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57712
OrthoDB 1 1.010 - - D1626636at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45986
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.