DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT5 and CG18004

DIOPT Version :10

Sequence 1:NP_000415.2 Gene:KRT5 / 3852 HGNCID:6442 Length:590 Species:Homo sapiens
Sequence 2:NP_610625.1 Gene:CG18004 / 36154 FlyBaseID:FBgn0033566 Length:297 Species:Drosophila melanogaster


Alignment Length:141 Identity:29/141 - (20%)
Similarity:51/141 - (36%) Gaps:43/141 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   407 CANLQN----AIADAEQRGELALKDARNKL-----------------------AELEEALQKAKQ 444
            |.:|.|    ||.|.....:...:.||:::                       .:.:|..:..|:
  Fly     7 CRSLANQEDGAIKDEPPSDDEPAQPARDRVPPISRGAAPASSSSVSAGLGAGETDFKERYKNLKK 71

Human   445 DMARLLRE---YQELMNT------KLALDVEIATYRKLLEGEECRLSGEGVGPVNISVVTSSVSS 500
            .:..|:.|   :|:|::|      |::.|......|.|:..:..:.|.:       |..|.|..|
  Fly    72 KLKFLIYENEYFQDLLHTNQRRLLKVSRDRTFLLDRLLVYEKPAKDSSD-------SDATDSSDS 129

Human   501 GYGSGSGYGGG 511
            ...|.||..||
  Fly   130 EPASTSGVAGG 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT5NP_000415.2 Head 1..167
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Keratin_2_head 16..164 CDD:465068
Filament 167..480 CDD:459643 19/108 (18%)
Coil 1A 168..203
Linker 1 204..222
Coil 1B 223..315
Linker 12 316..338
Coil 2 339..477 19/105 (18%)
Tail 478..590 10/34 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 566..590
CG18004NP_610625.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.