DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT5 and CG5070

DIOPT Version :10

Sequence 1:NP_000415.2 Gene:KRT5 / 3852 HGNCID:6442 Length:590 Species:Homo sapiens
Sequence 2:NP_573198.1 Gene:CG5070 / 32705 FlyBaseID:FBgn0030824 Length:209 Species:Drosophila melanogaster


Alignment Length:210 Identity:58/210 - (27%)
Similarity:73/210 - (34%) Gaps:92/210 - (43%)


- Green bases have known domain annotations that are detailed below.


Human     7 VSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGYGSRSLYNLG-G 70
            ||....|..:|...:.:....:.:.:      |.|.|||:|          .|||..|.|..| |
  Fly    15 VSLAKPGEATFGKLNLLLGGATTSGY------GSGYGGGYG----------SGYGYGSGYGSGYG 63

Human    71 S----------KRISIST-----SGGSFRNRFGAGAGGGY--GFGGGAGSGF------------- 105
            :          |.|.:|.     .||.:...:|.|.||||  |:|||..|||             
  Fly    64 AGYGYAPENVVKVIKVSVVPGGGIGGGYGGSYGGGYGGGYTGGYGGGYSSGFVGAAPAISTSAVV 128

Human   106 ------------------------GFGGGAGGGFG-----LGGGA------GFGGGFG-----GP 130
                                    ||||..|||.|     .||||      |:|.|:|     |.
  Fly   129 TPVVTSVSTPVATPVLAGGAGYVGGFGGALGGGLGGYGSSFGGGAALPASYGYGAGYGAGGGFGL 193

Human   131 GFPVCPP-----GGI 140
            ||...||     ||:
  Fly   194 GFGAPPPPLGLAGGL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT5NP_000415.2 Head 1..167 58/210 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 4/12 (33%)
Keratin_2_head 16..164 CDD:465068 55/201 (27%)
Filament 167..480 CDD:459643
Coil 1A 168..203
Linker 1 204..222
Coil 1B 223..315
Linker 12 316..338
Coil 2 339..477
Tail 478..590
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 566..590
CG5070NP_573198.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.