DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1309 and AT1G13610

DIOPT Version :9

Sequence 1:NP_647880.1 Gene:CG1309 / 38519 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_172818.2 Gene:AT1G13610 / 837922 AraportID:AT1G13610 Length:358 Species:Arabidopsis thaliana


Alignment Length:302 Identity:69/302 - (22%)
Similarity:124/302 - (41%) Gaps:61/302 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LAINTFGLSMIY-----PGSVKLLQKLMRPMLIS-GRAKLIEDDNGIRYKVKTIDSNEIDTLFID 233
            :|.:|....:.:     |....:.::....|:|| .....:.|:|....|::|...|||..:::.
plant     3 IATSTMAAKLAFFPPNPPSYTVVTEESTGKMMISTNLPHYLRDENIEVVKIRTKRGNEIVAMYVK 67

  Fly   234 NRPNNVGNGKTLVICSEGNAG-----FYEVGIMATPVALKYSVLGWNHPGFAGSTGTPHPHQDKN 293
            |     ...|..|:.|.|||.     ||   |:|..:.|..:::|:::.|:..|:|.|.......
plant    68 N-----PTAKLTVLFSHGNASDLAQIFY---ILAELIQLNVNLMGYDYSGYGQSSGKPSEQDTYA 124

  Fly   294 AIDAVVQFAINNLRFPVEDIILYGWSIGGFSTLYAASVYPDVKGVVLDATFDDVLYLAVPRMPAA 358
            .|:|...:.........|.|||||.|:|...:|..||..|.::.:||.:.|              
plant   125 DIEAAYNWLRQTYGTKDERIILYGQSVGSGPSLELASRLPRLRALVLHSPF-------------- 175

  Fly   359 LAGI-VKVAIRN------YCNLNNAELANEFNGPISFIRRTEDEIIAEDNHIDTNRGNFLVLSVL 416
            |:|: |...:::      |.|::...|.   ..|:..|..|:|::      ::.:.|..| ..:.
plant   176 LSGLRVMYPVKHSFPFDIYKNIDKIHLV---ECPVLVIHGTDDDV------VNISHGKHL-WGLC 230

  Fly   417 KHRYPNIFGASQLNKAKGLLSKPLEPYSIP------VADEKL 452
            |.:|..::     .|.:|.....:.|..:|      .|.|||
plant   231 KEKYEPLW-----LKGRGHSDIEMSPEYLPHLRKFISAIEKL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 32/115 (28%)
AT1G13610NP_172818.2 FrsA <74..261 CDD:223999 50/218 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12277
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.