DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1309 and AT5G38220

DIOPT Version :9

Sequence 1:NP_647880.1 Gene:CG1309 / 38519 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001031978.1 Gene:AT5G38220 / 833804 AraportID:AT5G38220 Length:336 Species:Arabidopsis thaliana


Alignment Length:219 Identity:56/219 - (25%)
Similarity:90/219 - (41%) Gaps:29/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 KVKTIDSNEIDTLFIDNRPNNVGNGKTLVICSEGNAG----FYEVGIMATPVALKYSVLGWNHPG 278
            |:||...|||..::| ..|.  .||..|.  |.|||.    .:|:.|..:. .|:.:::|:::.|
plant    46 KLKTRRGNEIVAIYI-KHPK--ANGTLLY--SHGNAADLGQMFELFIELSN-RLRLNLMGYDYSG 104

  Fly   279 FAGSTGTPHPHQDKNAIDAVVQFAINNLRFPVEDIILYGWSIGGFSTLYAASVYPDVKGVVLDAT 343
            :..|||..........|||.......:.....:.:||||.|:|...|:..||..|:::||||.:.
plant   105 YGQSTGKASECNTYADIDAAYTCLKEHYGVKDDQLILYGQSVGSGPTIDLASRTPNLRGVVLHSP 169

  Fly   344 FDDVLYLAVPRMPAALAGIVKVAIRNYCNLNNAELANEFNGPISFIRRTEDEIIAEDNHIDTNRG 408
            ....:.:..|........|.|          |.:.......|:..|..|.||:      :|.:.|
plant   170 ILSGMRVLYPVKRTYWFDIYK----------NIDKIGAVTCPVLVIHGTADEV------VDCSHG 218

  Fly   409 NFLVLSVLKHRYPNIF--GASQLN 430
            ..| ..:.|.:|..::  |....|
plant   219 KQL-WELSKEKYEPLWVSGGGHCN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 31/114 (27%)
AT5G38220NP_001031978.1 FrsA 14..239 CDD:223999 55/215 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12277
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.