DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1309 and AT3G30380

DIOPT Version :9

Sequence 1:NP_647880.1 Gene:CG1309 / 38519 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_189657.1 Gene:AT3G30380 / 822739 AraportID:AT3G30380 Length:399 Species:Arabidopsis thaliana


Alignment Length:207 Identity:50/207 - (24%)
Similarity:91/207 - (43%) Gaps:28/207 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LISGRAKLIEDDNGIR-----YKVKTIDSNEIDTLFIDNRPNNVGNGKTLVICSEGNAGFYEVGI 260
            ::.|:.:||..:| ::     .|:||...|::...:|.|     ......::.|.|||.  ::|.
plant    26 VVEGKLRLIGVEN-VKENVEVLKLKTKRGNQVVAAYIKN-----PTASLTLLYSHGNAA--DLGQ 82

  Fly   261 M-----ATPVALKYSVLGWNHPGFAGSTGTPHPHQDKNAIDAVVQFAINNLRFPVEDIILYGWSI 320
            |     ...:.|:.:::|:::.|:..|:|.|......:.|:||.:..........:|:||||.|:
plant    83 MFELFSELSLHLRVNLIGYDYSGYGRSSGKPSEQNTYSDIEAVYRCLEEKYGVKEQDVILYGQSV 147

  Fly   321 GGFSTLYAASVYPDVKGVVLDATFDDVLYLAVPRMPAALAGIVKVAIRNYCNLNNAELANEFNGP 385
            |...||..||..|:::.|||.:.....|.:..|........|.|          |.|..:....|
plant   148 GSGPTLELASRLPNLRAVVLHSAIASGLRVMYPVKRTYWFDIYK----------NVEKISFVKCP 202

  Fly   386 ISFIRRTEDEII 397
            :..|..|.|:::
plant   203 VLVIHGTSDDVV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 32/115 (28%)
AT3G30380NP_189657.1 MhpC 69..260 CDD:223669 40/158 (25%)
Abhydrolase_5 69..241 CDD:289465 40/158 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12277
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.