DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1309 and AT2G24320

DIOPT Version :9

Sequence 1:NP_647880.1 Gene:CG1309 / 38519 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001324569.1 Gene:AT2G24320 / 816968 AraportID:AT2G24320 Length:293 Species:Arabidopsis thaliana


Alignment Length:199 Identity:45/199 - (22%)
Similarity:81/199 - (40%) Gaps:46/199 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 KTIDSNEIDTLFIDNRPNNVGN-----------GKTLVICSEGNAGFYEVGIMA-----TPVALK 268
            |::|.:::.|        ..||           .:..::.|.|||.  ::|.|.     ....|:
plant    41 KSMDVHQLTT--------KSGNKVIATFWKHPFSRFTLLYSHGNAA--DLGQMVDLFIELRAHLR 95

  Fly   269 YSVLGWNHPGFAGSTGTPHPHQDKNAIDAVVQFAINNLRFPVEDIILYGWSIGGFSTLYAASVYP 333
            .:::.:::.|:..|||.|........|:||............|::||||.|:|...||:.||...
plant    96 VNIMSYDYSGYGASTGKPTELNTYYDIEAVYNCLRTEYGIMQEEMILYGQSVGSGPTLHLASRVK 160

  Fly   334 DVKGVVLDATFDDVLYLAVPRMPAALAGI-----VKVAIRNYCNLNNAELANEFNGPISFIRRTE 393
            .::|:||.:              |.|:|:     ||:... :....|.:.......|:..|..|:
plant   161 RLRGIVLHS--------------AILSGLRVLYPVKMTFW-FDMYKNIDKIRHVTCPVLVIHGTK 210

  Fly   394 DEII 397
            |:|:
plant   211 DDIV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 29/115 (25%)
AT2G24320NP_001324569.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12277
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.