DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1309 and abhd12

DIOPT Version :9

Sequence 1:NP_647880.1 Gene:CG1309 / 38519 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001070065.1 Gene:abhd12 / 767657 ZFINID:ZDB-GENE-060929-268 Length:382 Species:Danio rerio


Alignment Length:255 Identity:46/255 - (18%)
Similarity:101/255 - (39%) Gaps:59/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 GIRYKVKTIDSNEIDTLFIDNRPNNVGNGKTLVICSEGNAGF----YEVGIMATPVALKYSVLGW 274
            |:..:.:..|:...:..|..:.|        :::...||||.    :.|.:.....:|.|.|:.:
Zfish   133 GMWREAQAKDAEWYEKSFQSSHP--------VILYLHGNAGTRGGDHRVQLYKVLSSLGYHVVTF 189

  Fly   275 NHPGFAGSTGTPHPHQDKNAIDAVVQFAINNLRFPVEDIILYGWSIG-GFST-----LYAASVYP 333
            ::.|:..|.|:  |.:.....||:..:.....|...:.:.::|.|:| |.:|     |......|
Zfish   190 DYRGWGDSEGS--PSERGMTSDALFLYQWIKQRIGPKPLYIWGHSLGTGVATNLVRRLCDRGTPP 252

  Fly   334 DVKGVVLDATFDDV-----------LYLAVPR-----MPAALAGIVKVAIRNYCNLNNAELANEF 382
            |  .::|::.|.::           :|..:|.     :.|..|..::.|        :.|..|..
Zfish   253 D--ALILESPFTNIREEAKSHPFSMVYRYLPGFDWFFLDAISANDIRFA--------SDENVNHI 307

  Fly   383 NGPISFIRRTEDEII------------AEDNHIDTNRGNFLVL-SVLKHRYPNIFGASQL 429
            :.|:..:...:|.::            |:...::.::..|:.. |.|.:|:..|:.:.||
Zfish   308 SCPVLILHAEDDTVVPFQLGKKLYDLAAQSKSLNGHKVQFIPFSSSLGYRHKFIYKSPQL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 27/136 (20%)
abhd12NP_001070065.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
Hydrolase_4 151..340 CDD:378820 36/208 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.