DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1309 and Abhd12b

DIOPT Version :9

Sequence 1:NP_647880.1 Gene:CG1309 / 38519 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001382659.1 Gene:Abhd12b / 408202 RGDID:1303145 Length:361 Species:Rattus norvegicus


Alignment Length:304 Identity:62/304 - (20%)
Similarity:100/304 - (32%) Gaps:128/304 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 NGKTLVICSEGNAGFYEVGIMATPVALK---------YSVLGWNHPGFAGSTGTPHPHQDKNAID 296
            :|..:::...|:|..     .|.|..:|         :.||..::.||..||||  |.::....|
  Rat   136 DGNPIIVYLHGSAEH-----RAAPPRIKLAQVLSDGGFHVLSVDYRGFGDSTGT--PTEEGLTTD 193

  Fly   297 AVVQFAINNLRFPVEDIILYGWSIG-GFSTLYA----ASVYPDVKGVVLDATFDDV--------- 347
            ||..:.....|.....:.|:|.|:| |.:|..|    |..|| |..:||:|.|.::         
  Rat   194 AVCVYEWAKTRSGGTPVCLWGHSLGTGVATNAARALEAKGYP-VDAIVLEAPFTNMWVASINYPL 257

  Fly   348 --LYLAVPRMPAALAGIVKVAIRNYCNLNNAELANEFNGPISFIRRTEDEIIAEDNHIDTNRGNF 410
              :|..:||....|....|                            ||:|:             
  Rat   258 LKIYQKLPRCLRTLMDAFK----------------------------EDKIV------------- 281

  Fly   411 LVLSVLKHRYPNIFGASQLNKAKGLLSKPLEPYSIPVADEKLCMSRLITYASDEGKSFPMNIG-- 473
                     :||       ::....||.||                ||.:..|: ::.|:..|  
  Rat   282 ---------FPN-------DENVKFLSSPL----------------LILHGEDD-RTVPLEYGKQ 313

  Fly   474 ------ADYSEEVRNLMAVF-------------LLRKHLRDYNS 498
                  :.|..:.|..|.||             :|.:.:||:.|
  Rat   314 LYEIARSAYRNKDRVKMVVFPPGYHHNLLCESPMLIRSVRDFLS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 36/135 (27%)
Abhd12bNP_001382659.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.