DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1309 and CG33096

DIOPT Version :9

Sequence 1:NP_647880.1 Gene:CG1309 / 38519 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster


Alignment Length:320 Identity:65/320 - (20%)
Similarity:112/320 - (35%) Gaps:102/320 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 DDNGIRYKVKTID----------SNEIDTLFIDNRPNNV---------GNGKTLVICSEGNA--- 253
            ||..|||.::..|          .::::..|......|:         .|.|..::.|.|||   
  Fly    39 DDTNIRYNLQLFDRAEWQYSEREKSKVEAFFTRTSRGNLITCIYVRCSKNAKYTLLFSHGNAVDL 103

  Fly   254 ----GFYEVGIMATPVALKYSVLGWNHPGFAGSTGTPHPHQDKNA---IDAVVQFAINNLRFPVE 311
                .||    :.....:..::.|:::.|:..|.|.|   .:||.   |:|..|..........|
  Fly   104 GQMSSFY----LTLGSQINCNIFGYDYSGYGMSGGKP---SEKNLYADIEAAWQAMRTRFNISPE 161

  Fly   312 DIILYGWSIGGFSTLYAASVYPDVKGVVLDATFDDVLYLAVPRMPAALAGIVKVAIRN------Y 370
            .|||||.|||...|:..||.: :|..|:|.:          |.|..     ::|..||      :
  Fly   162 TIILYGQSIGTVPTVDLASRH-EVGAVILHS----------PLMSG-----LRVVFRNTKRTWFF 210

  Fly   371 CNLNNAELANEFNGPISFIRRTEDEIIAEDNHIDTNRGNFLVLSVLKHRYPNIFGASQLNKAKGL 435
            ....:.:...:...|:..|..|:||:|...:.|.           :..|.|              
  Fly   211 DAFPSIDKVAKVKAPVLVIHGTDDEVIDFSHGIG-----------IYERCP-------------- 250

  Fly   436 LSKPLEPYSIPVADEKLCMSRLITYASDEGKSFPMNIGADYSEEVRNLMAVFLLRKHLRD 495
              |.:||:.:..|...                 .:.:...|.|.:|..::|.|::..|::
  Fly   251 --KTVEPFWVEGAGHN-----------------DVELHPHYYERLRKFLSVELVKXQLKN 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 32/120 (27%)
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 52/254 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12277
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.