DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1309 and ABHD12B

DIOPT Version :9

Sequence 1:NP_647880.1 Gene:CG1309 / 38519 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001193602.1 Gene:ABHD12B / 145447 HGNCID:19837 Length:362 Species:Homo sapiens


Alignment Length:244 Identity:52/244 - (21%)
Similarity:88/244 - (36%) Gaps:85/244 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 KTLVICSEGNAGFYEVGIMATPVALKYSVLGWNHPGFAGSTGTPHPHQDKNAIDAVVQFAINNLR 307
            |.:.:.|:|  ||:              ||..::.||..|||  .|.::....||:..:.....|
Human   159 KLVKVLSDG--GFH--------------VLSVDYRGFGDSTG--KPTEEGLTTDAICVYEWTKAR 205

  Fly   308 FPVEDIILYGWSIGGFSTLYAASVYPD----VKGVVLDATFDDVLYLAVPRMPAALAGIVKVAIR 368
            ..:..:.|:|.|:|......||.|..:    |..:||:|.|.: :::|....|     ::|:   
Human   206 SGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTN-MWVASINYP-----LLKI--- 261

  Fly   369 NYCNLNNAELANEFNGPISFIRRTEDEIIAEDNHIDTNRGNFLVLSVLKHRYPNIFGASQLNKAK 433
             |.|:.            .|:|...| .:.:|..|                :||       ::..
Human   262 -YRNIP------------GFLRTLMD-ALRKDKII----------------FPN-------DENV 289

  Fly   434 GLLSKPLEPYSIPVADEKLCMSRLITYASDEGKSFPMNIGADYSEEVRN 482
            ..||.||                ||.:..|: ::.|:..|....|..||
Human   290 KFLSSPL----------------LILHGEDD-RTVPLEYGKKLYEIARN 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 28/114 (25%)
ABHD12BNP_001193602.1 Hydrolase_4 141..343 CDD:288960 52/244 (21%)
Abhydrolase_5 142..324 CDD:289465 52/244 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.