DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15011 and stc

DIOPT Version :9

Sequence 1:NP_647879.1 Gene:CG15011 / 38518 FlyBaseID:FBgn0035518 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_476599.1 Gene:stc / 34888 FlyBaseID:FBgn0001978 Length:1106 Species:Drosophila melanogaster


Alignment Length:859 Identity:257/859 - (29%)
Similarity:354/859 - (41%) Gaps:221/859 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NKAQAKNLAAAQKLVDTYASSSEDEGELDENHILELLYKNYKPSDNAGSSKEAARTSTFLENTLH 69
            |:.:......|...:||...|:....| .::.:.::..:...|...|.:.|.:.|..  |...:.
  Fly   319 NRDRINGFPRAVDDLDTSNESAHPSPE-KQSQLQQISPRRGPPLPPADNEKLSQREK--LVRDIE 380

  Fly    70 SGAATCLICIGSIRRVEAIWSCESCYCFFHLKCIQRWANDSMMQMKVKAAEQQNGQGHYNHLGEF 134
            .....||:|:.:|:..:..|||.:||...||||...||:.|                        
  Fly   381 QRRLECLVCVEAIKSHQPTWSCRNCYHMLHLKCTITWASSS------------------------ 421

  Fly   135 VPPKRQKSLHWCCPKCRRDYQPADKPTQYNCFCGKEVNPENQPFLVPHSCGEHCGKLLQPKCGHD 199
                 :..:.|.||.|:...|  |.|..|.|||||..||......:.|||||.|.::  ..|.|.
  Fly   422 -----KSEVGWRCPACQNVLQ--DLPRDYLCFCGKLKNPPVSRTELAHSCGEVCCRI--EGCSHA 477

  Fly   200 CKLLCHPGPCPPCAQQAQVSCLCGKSSPRSVRCIDKQWT-CQQTCKELLACGKHKCNQVCHQPGK 263
            |.|||||||||||......||.||:|: ::::|..|:.. |.:.|.:||.||:|:|...||. ||
  Fly   478 CTLLCHPGPCPPCQANVVRSCGCGRST-KTMQCAMKEEVLCGEICDKLLNCGEHRCQAECHS-GK 540

  Fly   264 CPPCTSKSLQPCECQRESKMVNCS-----DRKWKCQNVCGAPFACGLHICEKVCHAGPCGDGEC- 322
            |..|:.:.:|.|.|.::.:.|.|:     .|.:.|::.||.|..||.|.|:..||||.|  ..| 
  Fly   541 CAACSEQVVQQCHCGKQERKVPCTRESQDKRTYSCKDSCGQPLPCGHHKCKDSCHAGSC--RPCK 603

  Fly   323 --PLQVRSCPCGKNT----QVRPCNETEETCGDTCQKLLSCGQ----HTCTQRCHRGPCISCPIR 377
              |.|:.||||||..    |...|.:...||...|.:.|.||:    |.|..:||.|.|..||.:
  Fly   604 LSPEQITSCPCGKMPVPAGQRSSCLDPIPTCEGICSRTLRCGKPAHPHQCGSKCHLGQCPPCPKQ 668

  Fly   378 TKKKCRCGLHEKELPC------SKEFACETKCKQMRDCGKHACNRKCCGDQCPPCEKICGKQLSC 436
            |..|||||..::.:.|      :.:..|:.:|.:.|.||||.||.:||.|....|...|.:.|||
  Fly   669 TGVKCRCGHMDQMIKCRQLCNRADDARCKRRCTKKRSCGKHKCNVECCIDIDHDCPLPCNRTLSC 733

  Fly   437 NKHKCQSVCHNGPCYPCKLES--QINCRCGK--TKKSVPCGRERSARIVC-LELCRITPKCHHAI 496
            .||||...||.|.|.||...|  ::.|.||.  ....||||.::.   :| |...||.| |.|..
  Fly   734 GKHKCDQPCHRGNCPPCYRSSFEELYCECGAEVIYPPVPCGTKKP---ICKLPCSRIHP-CDHPP 794

  Fly   497 KHRCHKG-DCPPCGQVCGLPNDTSKCGHICKARCHEAVRVNKPKEARPQAKKYEYKALPHPRCEE 560
            :|.||.| .||||                                                    
  Fly   795 QHNCHSGPTCPPC---------------------------------------------------- 807

  Fly   561 GVIVT---CIGGHEV-ATWPCWNSKPT-SCQRSCARQLKCGNHKCSLVCHFVPLPQDMSAQTGCA 620
             :|.|   |.|.||: .|.||  |:|. ||..:|.:.|.||.|||...||..|      .|:...
  Fly   808 -MIFTTKLCHGNHELRKTIPC--SQPNFSCGMACGKPLPCGGHKCIKPCHEGP------CQSAGE 863

  Fly   621 NCEEGCTVPRPTGCIHACPKGCHPPPC--APCNFVIKTKCHCGLNQLVYKCNEYYDETGSVQEII 683
            .|.:.||.|||| |.|.|...||...|  .||..:::.:|.||                      
  Fly   864 ICRQSCTKPRPT-CGHKCAAACHEGACPETPCKELVEVQCECG---------------------- 905

  Fly   684 ERREKLRSCGNRCLKNYPCGHRCTAICHTGKCPNPELCRKKVRIFCACKRLK------------- 735
             .|::.|||                         .||.|:..||  |..:|.             
  Fly   906 -NRKQNRSC-------------------------QELAREHSRI--ATIQLASSMAEMSRGNYME 942

  Fly   736 -QEIACDKHRAGQTFLDCDSNCK-AEQIRVQAAEQLQLEQKRRDEEERNRLELEKFEAKFGKRKH 798
             .||.....::.:| |||:..|: .|:.|..||   .|.....|.:::...:..:|...|.|:  
  Fly   943 LSEILAPAKKSNKT-LDCNDECRLLERNRRLAA---ALSSGNSDTKQKCLTKYSEFVRGFAKK-- 1001

  Fly   799 KERKTVGSGPAKTK 812
                    .||.||
  Fly  1002 --------NPALTK 1007

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15011NP_647879.1 NF-X1-zinc-finger 184..228 CDD:100116 23/43 (53%)
NF-X1-zinc-finger 239..288 CDD:100116 19/53 (36%)
NF-X1-zinc-finger 293..342 CDD:100116 24/55 (44%)
NF-X1-zinc-finger 347..395 CDD:100116 20/57 (35%)
NF-X1-zinc-finger 426..474 CDD:100116 22/51 (43%)
NF-X1-zinc-finger 692..740 CDD:100116 10/61 (16%)
stcNP_476599.1 NF-X1-zinc-finger 464..510 CDD:100116 23/48 (48%)
NF-X1-zinc-finger 517..565 CDD:100116 19/48 (40%)
NF-X1-zinc-finger 575..617 CDD:100116 21/43 (49%)
NF-X1-zinc-finger 634..686 CDD:100116 20/51 (39%)
NF-X1-zinc-finger 723..775 CDD:100116 22/51 (43%)
NF-X1-zinc-finger 834..882 CDD:100116 22/54 (41%)
NF-X1-zinc-finger 865..915 CDD:100116 22/98 (22%)
R3H_NF-X1 996..1069 CDD:100072 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462296
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1952
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D22067at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.