DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1265 and MPDU1

DIOPT Version :9

Sequence 1:NP_647878.1 Gene:CG1265 / 38517 FlyBaseID:FBgn0035517 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_006721660.1 Gene:MPDU1 / 9526 HGNCID:7207 Length:260 Species:Homo sapiens


Alignment Length:79 Identity:24/79 - (30%)
Similarity:45/79 - (56%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LSLITVSSCLVIKVPQINTIRANESSKGISVLGLCLELFSYTVMLSYNYTSGYDFLSYMEYPVLL 89
            |.|..|:..|::|:||:..|...:|::|:|:..:.|||.:.|..:.|:.|:.:.|.|:.|...|:
Human    46 LGLGIVAGSLLVKLPQVFKILGAKSAEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLM 110

  Fly    90 LQEYALIYYAFKYQ 103
            ||...:.:....|:
Human   111 LQTITICFLVMHYR 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1265NP_647878.1 PQ-loop 22..80 CDD:282099 17/54 (31%)
MPDU1XP_006721660.1 PQ-loop 43..101 CDD:282099 17/54 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.