DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1265 and AT5G59470

DIOPT Version :9

Sequence 1:NP_647878.1 Gene:CG1265 / 38517 FlyBaseID:FBgn0035517 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_200755.1 Gene:AT5G59470 / 836066 AraportID:AT5G59470 Length:239 Species:Arabidopsis thaliana


Alignment Length:232 Identity:56/232 - (24%)
Similarity:109/232 - (46%) Gaps:20/232 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGALGDVVS-EYLERGPVL-VVADLLSLITVSSCLVIKVPQINTIRANESSKGISVLGLCLELF 63
            :|.|:|.:.: |:..:..:| :::.||....|::.:.:|:|||..|..|:|.||:||:...||:.
plant     8 LSCAIGSLRNGEFPAKDCLLPLISKLLGYFLVAASMTVKLPQIMKIVDNKSVKGLSVVAFELEVI 72

  Fly    64 SYTVMLSYNYTSGYDFLSYMEYPVLLLQEYALIYYAFKYQDLLGRRTQVVAILYSIVATLIYM-K 127
            .||:.|:|.......|.::.|...||:|...|:...:.:...|...|.|.||||..:|..::. |
plant    73 GYTISLAYCLNKDLPFSAFGELAFLLIQALILVACIYYFSQPLSVTTWVKAILYFAIAPTVFAGK 137

  Fly   128 LFPIII--------LKFLVPFCTPIGATSKVLQLLAILRTKDASSVSRTTWALSAFTNMTRIYTV 184
            :.|.:.        |.||         ::::.|:....|.|....:|..|..::....:.|::|.
plant   138 IDPFLFEALYASKHLIFL---------SARIPQIWKNFRNKSTGQLSFLTCLMNFGGALARVFTS 193

  Fly   185 FFQSHDWMLLSNFLISTFLSASVFTAACVYKKKAKAE 221
            ..:.....:|...::|.|.:..:.:...:|:.|...:
plant   194 IQEKAPLSMLLGIVLSIFTNGIIMSQILLYRSKGNED 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1265NP_647878.1 PQ-loop 22..80 CDD:282099 20/57 (35%)
AT5G59470NP_200755.1 2A43 29..224 CDD:130026 49/203 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1059579at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12226
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.