DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1265 and slc66a3

DIOPT Version :9

Sequence 1:NP_647878.1 Gene:CG1265 / 38517 FlyBaseID:FBgn0035517 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001004615.1 Gene:slc66a3 / 447876 ZFINID:ZDB-GENE-040912-40 Length:203 Species:Danio rerio


Alignment Length:199 Identity:61/199 - (30%)
Similarity:100/199 - (50%) Gaps:22/199 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TVSSCLVIKVPQINTIRANESSKGISVLGLCLELFSYTVMLSYNYTSGYDFLSYMEYPVLLLQEY 93
            |:..|:|:|.|||..:....::.|:|:..|.|||..:.|.:||.....|..|:|:|||:|:.|:.
Zfish    14 TLFVCMVLKFPQIFVLLRARAAAGVSLNSLLLELLGFIVFMSYQMYYEYPPLTYLEYPILIAQDV 78

  Fly    94 ALIYYAFKYQDLLGRRTQVVAILYSIVATLIYMKLFP-----IIILKFLV----PFCTPIGATSK 149
            .::.....|.             .::..:|||..||.     :.:.|:::    ..||.|..:||
Zfish    79 IVLLLILHYN-------------RNLKHSLIYAALFVGGWQLLTVKKWVIDLAMSLCTLISGSSK 130

  Fly   150 VLQLLAILRTKDASSVSRTTWALSAFTNMTRIYTVFFQSHDWMLLSNFLISTFLSASVFTAACVY 214
            :.||..:.|:||:..||..||||:.:|.|.||:|....:.|..:|..|::.|.|:..|......|
Zfish   131 LAQLQCLWRSKDSGQVSSLTWALATYTCMARIFTTIITTGDTQVLVRFIVMTILNMWVTATVIYY 195

  Fly   215 KKKA 218
            |.:|
Zfish   196 KPQA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1265NP_647878.1 PQ-loop 22..80 CDD:282099 17/50 (34%)
slc66a3NP_001004615.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593604
Domainoid 1 1.000 73 1.000 Domainoid score I9252
eggNOG 1 0.900 - - E1_KOG3211
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16454
Inparanoid 1 1.050 103 1.000 Inparanoid score I4945
OMA 1 1.010 - - QHG47627
OrthoDB 1 1.010 - - D1059579at2759
OrthoFinder 1 1.000 - - FOG0008406
OrthoInspector 1 1.000 - - oto40853
orthoMCL 1 0.900 - - OOG6_110752
Panther 1 1.100 - - LDO PTHR12226
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5753
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.